Cklfsf8 (CMTM8) Rabbit Polyclonal Antibody

CAT#: TA337583

Rabbit Polyclonal Anti-CMTM8 Antibody

Product Images

WB Suggested Anti-CMTM8 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CMTM8 antibody: synthetic peptide directed towards the middle region of human CMTM8. Synthetic peptide located within the following region: CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: CKLF like MARVEL transmembrane domain containing 8
• Database Link:
  NP_849199
  Entrez Gene 152189 Human
  UniProt ID Q8IZV2
• Background: Cmtm8 gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.
• Synonyms: CKLFSF8; CKLFSF8-V2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 86%; Mouse: 79%

Reference Data

• Protein Families: Transmembrane