CEP27 (HAUS2) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of HAUS augmin-like complex, subunit 2 (HAUS2), transcript variant 1
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "CEP27"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-HAUS2 antibody is: synthetic peptide directed towards the C-terminal region of Human HAUS2. Synthetic peptide located within the following region: LAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 25 kDa |
Gene Name | HAUS augmin like complex subunit 2 |
Database Link | |
Background | HAUS2 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly. |
Synonyms | C15orf25; CEP27; HsT17025 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rabbit: 86%; Guinea pig: 82%; Dog: 79%; Bovine: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.