BTBD14A (NACC2) Rabbit Polyclonal Antibody

CAT#: TA337259

Rabbit Polyclonal Anti-NACC2 Antibody

Product Images

WB Suggested Anti-BTBD14A Antibody Titration: 0.625 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BTBD14A antibody: synthetic peptide directed towards the N terminal of human BTBD14A. Synthetic peptide located within the following region: CDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELPGSVPPACFQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: NACC family member 2
• Database Link:
  NP_653254
  Entrez Gene 138151 Human
  UniProt ID Q96BF6
• Background: cDNA sequence was generated by The National Institutes of Health Mammalian Gene Collection (MGC) Program.
• Synonyms: BEND9; BTBD14; BTBD14A; BTBD31; NAC-2; RBB
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%