TIP120A (CAND1) Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "TIP120A"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CAND1 antibody: synthetic peptide directed towards the middle region of human CAND1. Synthetic peptide located within the following region: AALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQKDSSSTNLESMDTS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 136 kDa |
Gene Name | cullin associated and neddylation dissociated 1 |
Database Link | |
Background | CAND1 enhances transcription from various types of promoters. It is a regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. CAND1 prevents neddylation of CUL1 by physically blocking access to the neddylation site. CAND1 disrupts interactions between CUL1 and SKP1A and between CUL1 and F-box proteins. |
Synonyms | TIP120; TIP120A |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.