GPNMB Rabbit Polyclonal Antibody

CAT#: TA336175

Rabbit Polyclonal Anti-GPNMB Antibody

Product Images

WB Suggested Anti-GPNMB Antibody Titration: 0.2-1 ug/ml; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: glycoprotein nmb
• Database Link:
  NP_001005340
  Entrez Gene 10457 Human
  UniProt ID Q14956
• Background: GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly me
• Synonyms: HGFIN; NMB
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Guinea pig: 87%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane