LST 3TM12 (SLCO1B7) Rabbit Polyclonal Antibody

CAT#: TA336135

Rabbit Polyclonal Anti-LST-3TM12 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "LST 3TM12"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-LST-3TM12 Antibody: synthetic peptide directed towards the middle region of human LST-3TM12. Synthetic peptide located within the following region: LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 71 kDa
Gene Name solute carrier organic anion transporter family member 1B7 (putative)
Background The exact function of LST-3TM12 remains unknown.
Synonyms LST-3; LST-3TM12; LST3; SLC21A21
Note Immunogen Sequence Homology: Human: 100%; Rat: 91%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.