SLC35E2A Rabbit Polyclonal Antibody

CAT#: TA334629

Rabbit Polyclonal Anti-SLC35E2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of solute carrier family 35, member E2 (SLC35E2)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "SLC35E2A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SLC35E2 antibody: synthetic peptide directed towards the middle region of human SLC35E2. Synthetic peptide located within the following region: AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name solute carrier family 35 member E2
Background SLC35E2 is a putative transporter.
Synonyms DKFZp686M0869; FLJ34996; FLJ44537; KIAA0447; MGC104754; MGC117254; MGC126715; MGC138494
Note Immunogen Sequence Homology: Human: 100%; Horse: 79%; Rabbit: 79%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.