Isoleucyl tRNA synthetase (IARS) Rabbit Polyclonal Antibody

CAT#: TA334503

Rabbit Polyclonal Anti-ITPK1 Antibody

Product Images

WB Suggested Anti-ITPK1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ITPK1 antibody: synthetic peptide directed towards the middle region of human ITPK1. Synthetic peptide located within the following region: NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: isoleucyl-tRNA synthetase
• Database Link:
  NP_038203
  Entrez Gene 3376 Human
  UniProt ID P41252
• Background: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium.
• Synonyms: IARS1; ILERS; ILRS; IRS; PRO0785
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Aminoacyl-tRNA biosynthesis, Valine, leucine and isoleucine biosynthesis