SLC10A5 Rabbit Polyclonal Antibody

CAT#: TA334146

Rabbit Polyclonal Anti-SLC10A5 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "SLC10A5"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SLC10A5 Antibody: synthetic peptide directed towards the C terminal of human SLC10A5. Synthetic peptide located within the following region: GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 48 kDa
Gene Name solute carrier family 10 member 5
Background SLC10A5 is a new member of Solute Carrier Family 10 (SLC10) and the function remains unknown.
Synonyms P5
Note Immunogen sequence homology: Human: 100%; Rat: 91%; Horse: 86%; Pig: 79%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.