Germany
Japan
United Kingdom
China
PPIAL4C Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
Other products for "PPIAL4C"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-PPIAL4C Antibody is: synthetic peptide directed towards the C-terminal region of Human PPIAL4C. Synthetic peptide located within the following region: NGSQFFICAAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKIT |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 18 kDa |
| Gene Name | peptidylprolyl isomerase A like 4C |
| Database Link | |
| Background | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. |
| Synonyms | COAS-2 |
| Note | Immunogen sequence homology: Human: 100%; Rat: 86%; Horse: 85%; Dog: 79%; Pig: 79%; Goat: 79%; Mouse: 79%; Sheep: 79%; Bovine: 79%; Guinea pig: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.