Influenza Virus NS1A Binding Protein (IVNS1ABP) Rabbit Polyclonal Antibody

CAT#: TA332035

Rabbit Polyclonal Anti-IVNS1ABP Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of influenza virus NS1A binding protein (IVNS1ABP)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human influenza virus NS1A binding protein (IVNS1ABP), 20 µg
    • 20 ug

USD 867.00

Other products for "Influenza Virus NS1A Binding Protein"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-IVNS1ABP Antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP. Synthetic peptide located within the following region: RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 72 kDa
Gene Name influenza virus NS1A binding protein
Background This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.
Synonyms FLARA3; HSPC068; KLHL39; ND1; NS-1; NS1-BP; NS1BP
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Horse: 93%; Rabbit: 93%; Mouse: 92%; Bovine: 86%; Zebrafish: 86%; Guinea pig: 86%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.