Influenza Virus NS1A Binding Protein (IVNS1ABP) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of influenza virus NS1A binding protein (IVNS1ABP)
USD 436.00
Recombinant protein of human influenza virus NS1A binding protein (IVNS1ABP), 20 µg
USD 867.00
Other products for "Influenza Virus NS1A Binding Protein"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-IVNS1ABP Antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP. Synthetic peptide located within the following region: RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 72 kDa |
Gene Name | influenza virus NS1A binding protein |
Database Link | |
Background | This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered. |
Synonyms | FLARA3; HSPC068; KLHL39; ND1; NS-1; NS1-BP; NS1BP |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Horse: 93%; Rabbit: 93%; Mouse: 92%; Bovine: 86%; Zebrafish: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.