PMPCA Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of peptidase (mitochondrial processing) alpha (PMPCA), nuclear gene encoding mitochondrial protein
USD 665.00
Recombinant protein of human peptidase (mitochondrial processing) alpha (PMPCA), nuclear gene encoding mitochondrial protein, 20 µg
USD 867.00
Other products for "PMPCA"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PMPCA Antibody is: synthetic peptide directed towards the C-terminal region of Human PMPCA. Synthetic peptide located within the following region: IRNVKPEDVKRVASKMLRGKPAVAALGDLTDLPTYEHIQTALSSKDGRLP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 54 kDa |
Gene Name | peptidase, mitochondrial processing alpha subunit |
Database Link | |
Background | PMPCA cleaves presequences (transit peptides) from mitochondrial protein precursors. |
Synonyms | Alpha-MPP; INPP5E; P-55; SCAR2 |
Note | Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Horse: 92%; Bovine: 86%; Pig: 79%; Guinea pig: 79%; Dog: 77% |
Reference Data | |
Protein Families | Druggable Genome, Protease |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.