Aminoadipate aminotransferase (AADAT) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of aminoadipate aminotransferase (AADAT), transcript variant 1
USD 436.00
Recombinant protein of human aminoadipate aminotransferase (AADAT), transcript variant 1, 20 µg
USD 867.00
Other products for "Aminoadipate aminotransferase"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-AADAT Antibody: synthetic peptide directed towards the N terminal of human AADAT. Synthetic peptide located within the following region: AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 47 kDa |
Gene Name | aminoadipate aminotransferase |
Database Link | |
Background | AADAT is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties.This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Two alternative transcripts encoding the same isoform have been identified, however, additional alternative transcripts and isoforms may exist. |
Synonyms | KAT2; KATII; KYAT2 |
Note | Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Horse: 86%; Zebrafish: 86%; Rat: 85%; Pig: 79% |
Reference Data | |
Protein Pathways | Lysine biosynthesis, Lysine degradation, Metabolic pathways, Tryptophan metabolism |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.