C8ORF41 (TTI2) Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TTI2 Antibody is: synthetic peptide directed towards the N-terminal region of Human TTI2. Synthetic peptide located within the following region: THSLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFLHGENEDEKGRLSV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 56 kDa |
Gene Name | TELO2 interacting protein 2 |
Database Link | |
Background | TTI2 is a regulator of the DNA damage response (DDR). 'TTI2 is part of the TTT complex that is required to stabilize protein levels of the phosphatidylinositol 3-kinase-related protein kinase (PIKK) family proteins. The TTT complex is involved in the cellular resistance to DNA damage stresses, like ionizing radiation (IR), ultraviolet (UV) and mitomycin C (MMC). 'TTI2, together with the TTT complex and HSP90 may participate in the proper folding of newly synthesized PIKKs. |
Synonyms | C8orf41; MRT39 |
Note | Immunogen sequence homology: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 92%; Pig: 92%; Rabbit: 75%; Guinea pig: 75% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review