Germany
Japan
United Kingdom
China
PLEKHG4B Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Purified recombinant protein of Homo sapiens pleckstrin homology domain containing, family G (with RhoGef domain) member 4B (PLEKHG4B), 20 µg
USD 867.00
Other products for "PLEKHG4B"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-PLEKHG4B Antibody is: synthetic peptide directed towards the C-terminal region of Human PLEKHG4B. Synthetic peptide located within the following region: HVFLFEDLILFSKTQKVEGSHDVYLYKQSFKTAEIGMTENVGDSGLRFEI |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 139 kDa |
| Gene Name | pleckstrin homology and RhoGEF domain containing G4B |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | FLJ43173; KIAA1909 |
| Note | Immunogen sequence homology: Human: 100%; Horse: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.