CCDC12 Rabbit Polyclonal Antibody

CAT#: TA331652

Rabbit Polyclonal Anti-CCDC12 Antibody

Product Images

Host: Rabbit; Target Name: CCDC12; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CCDC12 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC12. Synthetic peptide located within the following region: EQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: coiled-coil domain containing 12
• Database Link:
  NP_653317
  Entrez Gene 151903 Human
  UniProt ID Q8WUD4
• Background: The function of this protein remains unknown.
• Synonyms: FLJ39430; FLJ40801; MGC23918
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 79%

Reference Data

• Protein Pathways: Spliceosome