Skor1 Rabbit Polyclonal Antibody

CAT#: TA329597

Rabbit polyclonal anti-Lbxcor1 antibody

Product Images

WB Suggested Anti-Lbxcor1 Antibody Titration: 0.2-1 ug/ml Positive Control: Mouse Kidney

Specifications

Product Data

• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Lbxcor1 antibody: synthetic peptide directed towards the middle region of mouse Lbxcor1. Synthetic peptide located within the following region: EPDKEDNHSTTADDLETRKSFSDQRSVSQPSPANTDRGEDGLTLDVTGTQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 100 kDa
• Gene Name: SKI family transcriptional corepressor 1
• Database Link:
  NP_766034
  Entrez Gene 207667 Mouse
  UniProt ID Q8BX46
• Background: Lbxcor1 inhibits BMP signaling. Lbxcor1 acts as a transcriptional corepressor of LBX1.
• Synonyms: AV273001; C230094B15Rik; Corl1; Lbxcor1
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Human: 86%; Rabbit: 86%