PNPLA5 Rabbit Polyclonal Antibody

CAT#: TA329580

Rabbit polyclonal anti-PNPLA5 antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of patatin-like phospholipase domain containing 5 (PNPLA5), transcript variant 2
    • 100 ug

USD 436.00

Other products for "PNPLA5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PNPLA5 antibody: synthetic peptide directed towards the C terminal of human PNPLA5. Synthetic peptide located within the following region: NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 48 kDa
Gene Name patatin like phospholipase domain containing 5
Background Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli (Wilson et al., 2006 [PubMed 16799181]). [supplied by OMIM].Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli (Wilson et al., 2006 [PubMed 16799181]). [supplied by OMIM]
Synonyms dJ388M5; dJ388M5.4; GS2L
Note Immunogen sequence homology: Human: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.