OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-COMMD8 antibodies

Anti-COMMD8 Antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA344959 Rabbit Polyclonal Anti-COMMD8 Antibody - middle region 50ug $325 3-7 Days
Add to Shopping Cart
spacer
WB(1)
spacer
Also for COMMD8 (NM_017845)
cDNA Clone shRNA/siRNA CRISPR KO Kit Protein Antibody

OriGene Data

ImmunogenThe immunogen for anti-COMMD8 antibody: synthetic peptide directed towards the middle region of human COMMD8. Synthetic peptide located within the following region: IAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQL
Clone Name IsotypeIgG
Species ReactivityBovine, Dog, Guinea pig, Horse, Mouse, Rat ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 21kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen Sequence Homology: Human: 100%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Dog: 86%; Rat: 86%; Rabbit: 86%; Yeast: 83%; Mouse: 79%; Bovine: 79%

Reference Data

Target NameHomo sapiens COMM domain containing 8 (COMMD8), transcript variant 1
Alternative NameFLJ20502
Database LinkNP_060315
Entrez Gene 0 Human
Entrez Gene 27784 Mouse
Entrez Gene 289603 Rat
Entrez Gene 0 Monkey
Entrez Gene 475138 Dog
FunctionThe function of COMMD8 remains unknown.
Related Pathway

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
WB Suggested Anti-COMMD8 Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T
grey_line

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge