Myeloperoxidase (MPO) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of myeloperoxidase (MPO), nuclear gene encoding mitochondrial protein
USD 665.00
Recombinant protein of human myeloperoxidase (MPO), nuclear gene encoding mitochondrial protein, 20 µg
USD 867.00
Other products for "Myeloperoxidase"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MPO antibody: synthetic peptide directed towards the N terminal of human MPO. Synthetic peptide located within the following region: QLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 84 kDa |
Gene Name | myeloperoxidase |
Database Link | |
Background | Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of netrophils. |
Synonyms | Myeloperoxidase |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Rat: 93%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Dog: 83%; Goat: 79%; Horse: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.