OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-ASIC2 antibodies

Anti-ASIC2 Antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA338514 Rabbit Polyclonal Anti-ACCN1 Antibody 50ug $325 3-7 days
LC405257 ASIC2 HEK293T cell transient overexpression lysate (as WB positive control) 20ug $50 In Stock
Add to Shopping Cart
spacer
WB(1)

OriGene Data

ImmunogenThe immunogen for anti-ACCN1 antibody: synthetic peptide directed towards the C terminal of human ACCN1. Synthetic peptide located within the following region: GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV
Clone Name IsotypeIgG
Species ReactivityHuman, Horse, Dog, Rabbit, Rat, Mouse, Bovine Concentration1mg/mL
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 63kDa
BufferShipped as lyophilized powder. 1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 93%; Bovine: 93%

Reference Data

Target Nameacid sensing ion channel subunit 2
Alternative NameACCN|ACCN1|ASIC2a|BNC1|BNaC1|MDEG|hBNaC1
Database LinkNP_899233
Entrez Gene 40 Human
Entrez Gene 11418 Mouse
Entrez Gene 25364 Rat
Entrez Gene 0 Monkey
Entrez Gene 491150 Dog
FunctionThis gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
Related PathwayIon Channels: OtherDruggable Genome Taste transduction

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
WB Suggested Anti-ACCN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate
grey_line

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge