OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-GRIN2A antibodies

Anti-GRIN2A Antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA338510 Rabbit Polyclonal Anti-GRIN2A Antibody 50ug $325 3-7 days
Add to Shopping Cart
spacer
WB(1)
IHC(1)

OriGene Data

ImmunogenThe immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
Clone Name IsotypeIgG
Species ReactivityHuman, Dog, Horse, Rat, Guinea pig, Mouse, Bovine Concentration1mg/mL
Guaranteed Application *WB, IHC Suggested DilutionsIHC, WB
Predicted MW Explanation 163kDa
BufferShipped as lyophilized powder. 1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 86%; Pig: 79%; Rat: 79%; Mouse: 79%; Guinea pig: 79%; Bovine: 77%

Reference Data

Target NameHomo sapiens glutamate ionotropic receptor NMDA type subunit 2A (GRIN2A), transcript variant 2
Alternative NameEPND; FESD; GluN2A; LKS; NMDAR2A; NR2A
Database LinkNP_000824
Entrez Gene 2903 Human
Entrez Gene 14811 Mouse
Entrez Gene 24409 Rat
Entrez Gene 0 Monkey
Entrez Gene 490012 Dog
FunctionThis gene encodes a member of the glutamate-gated ion channel protein family. The encoded protein is an N-methyl-D-aspartate (NMDA) receptor subunit. NMDA receptors are both ligand-gated and voltage-dependent, and are involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. These receptors are permeable to calcium ions, and activation results in a calcium influx into post-synaptic cells, which results in the activation of several signaling cascades. Disruption of this gene is associated with focal epilepsy and speech disorder with or without mental retardation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014].
Related PathwayIon Channels: SodiumTransmembraneIon Channels: Glutamate ReceptorsIon Channels: Glutamate ReceptorsDruggable Genome Calcium signaling pathwayNeuroactive ligand-receptor interactionLong-term potentiationAlzheimer's diseaseAmyotrophic lateral sclerosis (ALS)Systemic lupus erythematosusMore Pathways >>

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
WB Suggested Anti-GRIN2A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Muscle
grey_line

IHC Image
Sample Type . Rat Hippocampal Neurons - 14DIVPrimary Antibody Dilution . 1:200 Secondary Antibody . Anti-rabbit-Cy3Secondary Antibody Dilution . 1:500Color/Signal Descriptions . Green: GFP Red: NR2a Yellow: VGLUT12Gene Name . GRIN2ASubmitted by . Dan Fowl
grey_line

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge