OriGene Logo
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
Home Antibody All anti-IDO2 antibodies

Anti-IDO2 Antibody


Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA337716 Rabbit Polyclonal Anti-IDO2 Antibody 50ug $325 3-7 days
LC403659 IDO2 HEK293T cell transient overexpression lysate (as WB positive control) 20ug $50 In Stock
Add to Shopping Cart

OriGene Data

ImmunogenThe immunogen for anti-IDO2 antibody is: synthetic peptide directed towards the C-terminal region of Human IDO2. Synthetic peptide located within the following region: LITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILH
Clone Name IsotypeIgG
Species ReactivityBovine, Human, Dog, Horse, Pig, Mouse, Rat, Rabbit ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 47kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Horse: 92%; Pig: 91%; Mouse: 83%; Rat: 79%; Rabbit: 79%

Reference Data

Target NameHomo sapiens indoleamine 2,3-dioxygenase 2 (IDO2)
Alternative NameINDOL1; INDOL1
Database LinkNP_919270
Entrez Gene 169355 Human
Entrez Gene 209176 Mouse
Entrez Gene 681319 Rat
Entrez Gene 0 Monkey
Entrez Gene 482846 Dog
FunctionAlong with the enzymes encoded by the INDO and TDO2 genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway.
Related Pathway Tryptophan metabolismMetabolic pathways

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.

WB Image
WB Suggested Anti-IDO2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Brain


Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.
