OriGene Logo
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
Home Antibody All anti-ABCB7 antibodies

Anti-ABCB7 Antibody


Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA332141 Rabbit Polyclonal Anti-ABCB7 Antibody 50ug $325 3-7 days
Add to Shopping Cart

OriGene Data

ImmunogenThe immunogen for Anti-ABCB7 Antibody is: synthetic peptide directed towards the C-terminal region of Human ABCB7. Synthetic peptide located within the following region: DEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQG
Clone Name IsotypeIgG
Species ReactivityHuman, Bovine, Dog, Rat, Pig, Horse, Rabbit, Guinea pig, Mouse, Zebrafish, Yeast ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 78kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%; Yeast: 85%

Reference Data

Target NameHomo sapiens ATP binding cassette subfamily B member 7 (ABCB7), transcript variant 1
Alternative NameABC7; ASAT; Atm1p; EST140535
Database LinkNP_004290
Entrez Gene 22 Human
Entrez Gene 11306 Mouse
Entrez Gene 302395 Rat
Entrez Gene 0 Monkey
Entrez Gene 491967 Dog
FunctionThe membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a half-transporter involved in the transport of heme from the mitochondria to the cytosol. With iron/sulfur cluster precursors as its substrates, this protein may play a role in metal homeostasis. Mutations in this gene have been associated with mitochondrial iron accumulation and isodicentric (X)(q13) and sideroblastic anemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Related PathwayTransmembraneDruggable Genome ABC transporters

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.

WB Image
Host: Rabbit; Target Name: ABCB7; Sample Tissue: COLO205 Whole Cell lysates; Antibody Dilution: 1.0ug/ml; ABCB7 is supported by BioGPS gene expression data to be expressed in COLO205


Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.
