OriGene Logo
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
Home Antibody All anti-PDZD3 antibodies

Anti-PDZD3 Antibody


Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA331732 Rabbit Polyclonal Anti-PDZD3 Antibody 50ug $325 3-7 days
LC403028 PDZD3 HEK293T cell transient overexpression lysate (as WB positive control) 20ug $50 In Stock
Add to Shopping Cart

OriGene Data

ImmunogenThe immunogen for Anti-PDZD3 Antibody is: synthetic peptide directed towards the N-terminal region of Human PDZD3. Synthetic peptide located within the following region: PDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQG
Clone Name IsotypeIgG
Species ReactivityHuman, Pig, Rat, Dog, Guinea pig, Rabbit, Mouse, Horse, Bovine ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 42kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Guinea pig: 93%; Mouse: 86%; Rabbit: 86%; Horse: 79%; Bovine: 79%

Reference Data

Target NameHomo sapiens PDZ domain containing 3 (PDZD3), transcript variant 2
Alternative NameIKEPP; NHERF4; PDZK2
Database LinkNP_079067
Entrez Gene 79849 Human
Entrez Gene 170761 Mouse
Entrez Gene 500986 Rat
Entrez Gene 0 Monkey
Entrez Gene 610585 Dog
FunctionGuanylyl cyclase C (GCC, or GUCY2C; MIM 601330) produces cGMP following the binding of either endogenous ligands or heat-stable enterotoxins secreted by E. coli and other enteric bacteria. Activation of GCC initiates a signaling cascade that leads to phosphorylation of the cystic fibrosis transmembrane conductance regulator (CFTR; MIM 602421), followed by a net efflux of ions and water into the intestinal lumen. IKEPP is a regulatory protein that associates with GCC and regulates the amount of cGMP produced following receptor stimulation.
Related PathwayDruggable Genome

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.

WB Image
Host: Rabbit; Target Name: PDZD3; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml


Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.
