OriGene Technologies, Inc.
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-ABCC1 antibodies

Anti-ABCC1 Antibody IU5C1

div

Specifications Citations (0) Related Products Product Documents
SKU Description Amount Price Availability*  
TA309560
  • Mouse Monoclonal MRP1 Antibody (IU5C1)
  • Free Sample of Positive Control: HEK293T cell transient overexpression lysate (LC417598) , 20ug Explanation
0.1ml $325 In Stock
Add to Shopping Cart
spacer
WB(1)
IF(1)

OriGene Data

ImmunogenA recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. [Swiss-Prot# P33527]
Clone NameIU5C1 IsotypeIgG1
Species ReactivityHuman, Mouse ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB, IF Suggested DilutionsWB, IF
Buffer0.1% Sodium Azide
Purification Ascites

Reference Data

Target NameHomo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1)
Alternative NameABC29; ABCC; GS-X; MRP; MRP1
Database LinkNP_004987
Entrez Gene 4363 Human
Entrez Gene 17250 Mouse
Function
Related PathwayTransmembraneDruggable Genome ABC transporters

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.

Western Blot: MRP1 Antibody (IU5C1) -Detection of MRP1 in 10 ug of 293 transfected (lane 2) and empty vector (lane 1) lysate.
spacer
Immunofluorescence: MRP1 Antibody (IU5C1) - Immunofluorescent staining of MRP1 using anti-MRP1 in HEK293 cells with MRP1 expression.
spacer

 

spacer
Inc 5000 Healthcare Company
All Products by: Title | Price | Category | Popularity | Best Sellers Topselling Products by: Title | Price | Category | Popularity | Favorites
Popular Categories: Popularity | Our Choices | All-Round Favorites | Title Topselling Categories: Popularity | Our Choices | All-Round Favorites | Title