OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Recombinant Human Proteins All CCL14 Proteins

CCL14 (NM_032963) Purified Human Protein

Specifications Citations Customer Service Product Documents
Cat. No. Description Datasheet Price Availability*  
TP723153 Purified recombinant protein of Human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 3., 10 ug (Larger pack size?) 199
$139
5 Days
Add to Shopping Cart
spacer
Also for CCL14 (NM_032963)
cDNA Clone shRNA/siRNA CRISPR KO Kit Protein Antibody

OriGene Data
Species:Human Expression Host:E. coli
Expression cDNA Clone or AA Sequence
GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Tag:Tag-free Predicted MW:7.8 kDa
Purity:>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration:Resuspend the protein in the desired concentration in proper buffer
Buffer:Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
BioActivity: Determined by its ability to chemoattract human monocytes using a concentration range of 5.0-20.0 ng/ml.
Protein Families: Secreted ProteinDruggable Genome
Protein Pathways: Cytokine-cytokine receptor interactionChemokine signaling pathway
 

Reference Data
RefSeq: NP_116739 RefSeq Size: 481 RefSeq ORF: 279
LocusID: 6358 Cytogenetic: 17q12  
Synonyms : CC-1; CC-3; CKB1; HCC-1; HCC-1(1-74); HCC-1/HCC-3; HCC-3; MCIF; NCC-2; NCC2; SCYA14; SCYL2;
Summary: This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249. [provided by RefSeq, Dec 2009].
*: Inventory for certain proteins may be limited due to low expression level. Delivery time may vary from web posted schedule. Contact techsupport@origene.com for specific inventory information
**: DDK-tag is the same as FLAG tag. Flag® is a registered trademark of Sigma-Aldrich

 

bar
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge