OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Recombinant Human Proteins All EFNB1 Proteins

EFNB1 (NM_004429) Purified Human Protein

Specifications Citations Customer Service Product Documents
Cat. No. Description Datasheet Price Availability*  
TP721089 Purified recombinant protein of Human ephrin-B1 (EFNB1), 10 ug (Larger pack size?) $139 2 Weeks
Add to Shopping Cart
spacer
Also for EFNB1 (NM_004429)
cDNA Clone shRNA/siRNA CRISPR KO Kit Protein Antibody

OriGene Data
Species:Human Expression Host:HEK293 cells
Expression cDNA Clone or AA Sequence
LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGVDHHHHHH
Tag:C-terminal HIS Predicted MW:23.4kD
Purity:>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration:Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Buffer:Lyophilized from a 0.2 µM filtered solution of 20mM PB,150mM NaCl,pH7.4
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Protein Families: TransmembraneDruggable Genome
Protein Pathways: Axon guidance
 

Reference Data
RefSeq: NP_004420 RefSeq Size: 3346 RefSeq ORF: 1038
LocusID: 1947 Cytogenetic: Xq13.1  
Synonyms : CFND; CFNS; EFB1; EFL3; Elk-L; EPLG2; LERK2
Summary: The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008]
*: Inventory for certain proteins may be limited due to low expression level. Delivery time may vary from web posted schedule. Contact techsupport@origene.com for specific inventory information
**: DDK-tag is the same as FLAG tag. Flag® is a registered trademark of Sigma-Aldrich

 

bar
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge