CTIP1 (BCL11A) (NM_138559) Human Recombinant Protein

CAT#: TP323575

Recombinant protein of human B-cell CLL/lymphoma 11A (zinc finger protein) (BCL11A), transcript variant 3, 20 µg

Product Images

Coomassie blue staining of purified BCL11A protein (Cat# TP323575). The protein was produced from HEK293T cells transfected with BCL11A cDNA clone (Cat# RC223575) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223575 representing NM_138559
  Red=Cloning site Green=Tags(s)
  
  MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQ
  CNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSP
  RSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPR
  VLHTPPFGVVPRELKMCGSFRMEAREPLSSEKI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_612569
• Locus ID: 53335
• UniProt ID: Q9H165
• Cytogenetics: 2p16.1
• Refseq Size: 2358
• Refseq ORF: 729
• Synonyms: BCL11A-L; BCL11a-M; BCL11A-S; BCL11A-XL; CTIP1; DILOS; EVI9; HBFQTL5; ZNF856
• Summary: This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors