CTIP1 (BCL11A) (NM_138559) Human Recombinant Protein
CAT#: TP323575
Recombinant protein of human B-cell CLL/lymphoma 11A (zinc finger protein) (BCL11A), transcript variant 3, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223575 representing NM_138559
Red=Cloning site Green=Tags(s) MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQ CNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSP RSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPR VLHTPPFGVVPRELKMCGSFRMEAREPLSSEKI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612569 |
Locus ID | 53335 |
UniProt ID | Q9H165 |
Cytogenetics | 2p16.1 |
Refseq Size | 2358 |
Refseq ORF | 729 |
Synonyms | BCL11A-L; BCL11a-M; BCL11A-S; BCL11A-XL; CTIP1; DILOS; EVI9; HBFQTL5; ZNF856 |
Summary | This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408578 | BCL11A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC411466 | BCL11A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY408578 | Transient overexpression lysate of B-cell CLL/lymphoma 11A (zinc finger protein) (BCL11A), transcript variant 3 |
USD 436.00 |
|
LY411466 | Transient overexpression lysate of B-cell CLL/lymphoma 11A (zinc finger protein) (BCL11A), transcript variant 1 |
USD 665.00 |
|
PH323575 | BCL11A MS Standard C13 and N15-labeled recombinant protein (NP_612569) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review