GAGE2C (NM_001472) Human Mass Spec Standard

CAT#: PH318241

GAGE2C MS Standard C13 and N15-labeled recombinant protein (NP_001463)

Product Images

Coomassie blue staining of purified GAGE2C protein (Cat# TP318241). The protein was produced from HEK293T cells transfected with GAGE2C cDNA clone (Cat# RC218241) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218241
• Predicted MW: 12.6 kDa
• Protein Sequence:
  Sequence Link

  >RC218241 representing NM_001472
  Red=Cloning site Green=Tags(s)
  
  MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPK
  PEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001463
• RefSeq Size: 530
• RefSeq ORF: 348
• Synonyms: CT4.2; GAGE-2; GAGE-2C; GAGE2
• Locus ID: 2574
• UniProt ID: Q13066
• Cytogenetics: Xp11.23
• Summary: This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. [provided by RefSeq, Jul 2008]