TIM 1 (HAVCR1) (NM_001099414) Human Mass Spec Standard
CAT#: PH317289
HAVCR1 MS Standard C13 and N15-labeled recombinant protein (NP_001092884)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217289 |
Predicted MW | 39.25 kDa |
Protein Sequence |
>RC217289 representing NM_001099414
Red=Cloning site Green=Tags(s) MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVT YRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPT VTTVRTSTTVPTTTTVPMTTVPTTTVPTTMSIPTTTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVST FVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQ LFLEHSLLTANTTKGIYAGVCISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQA EDNIYIENSLYATD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001092884 |
RefSeq Size | 1493 |
RefSeq ORF | 1092 |
Synonyms | HAVCR; HAVCR-1; KIM-1; KIM1; TIM; TIM-1; TIM1; TIMD-1; TIMD1 |
Locus ID | 26762 |
UniProt ID | Q96D42 |
Cytogenetics | 5q33.3 |
Summary | The protein encoded by this gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. The encoded protein may be involved in the moderation of asthma and allergic diseases. The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 4, 12 and 19. [provided by RefSeq, Apr 2015] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415915 | HAVCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420451 | HAVCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415915 | Transient overexpression lysate of hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 1 |
USD 436.00 |
|
LY420451 | Transient overexpression lysate of hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 2 |
USD 436.00 |
|
PH317039 | HAVCR1 MS Standard C13 and N15-labeled recombinant protein (NP_036338) |
USD 3,255.00 |
|
TP317039 | Recombinant protein of human hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 1, 20 µg |
USD 867.00 |
|
TP317289 | Recombinant protein of human hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review