EBAG9 (NM_198120) Human Mass Spec Standard
CAT#: PH315667
EBAG9 MS Standard C13 and N15-labeled recombinant protein (NP_936056)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215667 |
Predicted MW | 24.4 kDa |
Protein Sequence |
>RC215667 protein sequence
Red=Cloning site Green=Tags(s) MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTS VKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFI HQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGV KLS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_936056 |
RefSeq Size | 2328 |
RefSeq ORF | 639 |
Synonyms | EB9; PDAF |
Locus ID | 9166 |
UniProt ID | O00559, A0A024R9E0 |
Cytogenetics | 8q23.2 |
Summary | This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Alternate splicing results in multiple transcript variants. A pseudogene of this gene has been defined on chromosome 10. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405069 | EBAG9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC418143 | EBAG9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC430709 | EBAG9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405069 | Transient overexpression lysate of estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 2 |
USD 436.00 |
|
LY418143 | Transient overexpression lysate of estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 1 |
USD 436.00 |
|
LY430709 | Transient overexpression lysate of estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 2 |
USD 436.00 |
|
PH305364 | EBAG9 MS Standard C13 and N15-labeled recombinant protein (NP_004206) |
USD 3,255.00 |
|
TP305364 | Recombinant protein of human estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 1, 20 µg |
USD 867.00 |
|
TP315667 | Recombinant protein of human estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review