C1orf86 (FAAP20) (NM_182533) Human Mass Spec Standard
CAT#: PH315561
C1orf86 MS Standard C13 and N15-labeled recombinant protein (NP_872339)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215561 |
Predicted MW | 19.6 kDa |
Protein Sequence |
>RC215561 representing NM_182533
Red=Cloning site Green=Tags(s) MEAARRPRLGLSRRRPPPAGGPSGGRPWFLLGGDERERLWAELLRTVSPELILDHEVPSLPAFPGQEPRC GPEPTEVFTVGPKTFSWTPFPPDLWGPGRSYRLLHGAGGHLESPARSLPQRPAPDPCRAPRVEQQPSVEG AAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_872339 |
RefSeq Size | 745 |
RefSeq ORF | 540 |
Synonyms | C1orf86; FP7162 |
Locus ID | 199990 |
UniProt ID | Q6NZ36 |
Cytogenetics | 1p36.33 |
Summary | Component of the Fanconi anemia (FA) complex required to recruit the FA complex to DNA interstrand cross-links (ICLs) and promote ICLs repair. Following DNA damage recognizes and binds 'Lys-63'-linked ubiquitin generated by RNF8 at ICLs and recruits other components of the FA complex. Promotes translesion synthesis via interaction with REV1.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405510 | C1orf86 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405510 | Transient overexpression lysate of chromosome 1 open reading frame 86 (C1orf86), transcript variant 2 |
USD 436.00 |
|
TP315561 | Recombinant protein of human chromosome 1 open reading frame 86 (C1orf86), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review