Amylin (IAPP) (NM_000415) Human Mass Spec Standard
CAT#: PH315074
IAPP MS Standard C13 and N15-labeled recombinant protein (NP_000406)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215074 |
Predicted MW | 9.81 kDa |
Protein Sequence |
>RC215074 representing NM_000415
Red=Cloning site Green=Tags(s) MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY GKRNAVEVLKREPLNYLPL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000406 |
RefSeq Size | 1462 |
RefSeq ORF | 267 |
Synonyms | DAP; IAP |
Locus ID | 3375 |
UniProt ID | P10997, A0A024RAU1 |
Cytogenetics | 12p12.1 |
Summary | This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type 2 diabetes exhibit reduced levels of the encoded hormone in blood and pancreas. This protein also exhibits a bactericidal, antimicrobial activity. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Maturity onset diabetes of the young |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400146 | IAPP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400146 | Transient overexpression lysate of islet amyloid polypeptide (IAPP) |
USD 436.00 |
|
TP315074 | Recombinant protein of human islet amyloid polypeptide precursor (IAPP), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review