RAB1B (NM_030981) Human Mass Spec Standard

CAT#: PH309927

RAB1B MS Standard C13 and N15-labeled recombinant protein (NP_112243)

Product Images

Coomassie blue staining of purified RAB1B protein (Cat# TP309927). The protein was produced from HEK293T cells transfected with RAB1B cDNA clone (Cat# RC209927) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209927
• Predicted MW: 22.2 kDa
• Protein Sequence:
  Sequence Link

  >RC209927 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERF
  RTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFA
  DSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_112243
• RefSeq Size: 1955
• RefSeq ORF: 603
• Locus ID: 81876
• UniProt ID: Q9H0U4
• Cytogenetics: 11q13.2
• Summary: Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al., 1997 [PubMed 9030196]; Alvarez et al., 2003 [PubMed 12802079]).[supplied by OMIM, Jan 2009]
• Protein Families: Transcription Factors