LACRT (NM_033277) Human Mass Spec Standard

CAT#: PH309355

LACRT MS Standard C13 and N15-labeled recombinant protein (NP_150593)

Product Images

Coomassie blue staining of purified LACRT protein (Cat# TP309355). The protein was produced from HEK293T cells transfected with LACRT cDNA clone (Cat# RC209355) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209355
• Predicted MW: 14.2 kDa
• Protein Sequence:
  Sequence Link

  >RC209355 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKFTTLLFLAAVAGALVYAEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQG
  TAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_150593
• RefSeq Size: 508
• RefSeq ORF: 414
• Locus ID: 90070
• UniProt ID: Q9GZZ8
• Cytogenetics: 12q13.2
• Summary: The protein encoded by this gene is highly expressed in the lacrimal glands and localized primarily to secretory granules and secretory fluid. It augments lacrimal acinar cell secretion, promotes ductal cell proliferation, and stimulates signaling through tyrosine phosphorylation and release of calcium. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein