ICOS Ligand (ICOSLG) (NM_015259) Human Mass Spec Standard
CAT#: PH308975
ICOSLG MS Standard C13 and N15-labeled recombinant protein (NP_056074)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208975 |
Predicted MW | 33.3 kDa |
Protein Sequence |
>RC208975 protein sequence
Red=Cloning site Green=Tags(s) MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQN SSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSV PVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPS VNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDR CLQHSYAGAWAVSPETELTGHV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_056074 |
RefSeq Size | 3320 |
RefSeq ORF | 906 |
Synonyms | B7-H2; B7h; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS |
Locus ID | 23308 |
UniProt ID | O75144, A0N0L8 |
Cytogenetics | 21q22.3 |
Summary | Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402420 | ICOSLG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402420 | Transient overexpression lysate of inducible T-cell co-stimulator ligand (ICOSLG) |
USD 436.00 |
|
TP308975 | Recombinant protein of human inducible T-cell co-stimulator ligand (ICOSLG), 20 µg |
USD 867.00 |
|
TP700281 | Purified recombinant protein of human inducible T-cell co-stimulator ligand (ICOSLG), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 867.00 |
|
TP720398 | Recombinant protein of human inducible T-cell co-stimulator ligand (ICOSLG) |
USD 330.00 |
|
TP723952 | Human B7-H2 Protein, mFc-His Tag |
USD 495.00 |
{0} Product Review(s)
Be the first one to submit a review