C20orf103 (LAMP5) (NM_012261) Human Mass Spec Standard

CAT#: PH308732

C20orf103 MS Standard C13 and N15-labeled recombinant protein (NP_036393)

Product Images

Coomassie blue staining of purified LAMP5 protein (Cat# TP308732). The protein was produced from HEK293T cells transfected with LAMP5 cDNA clone (Cat# RC208732) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208732
• Predicted MW: 31.5 kDa
• Protein Sequence:
  Sequence Link

  >RC208732 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLQGRGVPSIDRLRVLLMLFHTMAQIMAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPY
  DVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSK
  VQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQP
  FDIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHKMTANQVQIPRDRSQYKHMG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036393
• RefSeq Size: 2059
• RefSeq ORF: 840
• Synonyms: BAD-LAMP; BADLAMP; C20orf103; LAMP-5; UNC-46
• Locus ID: 24141
• UniProt ID: Q9UJQ1
• Cytogenetics: 20p12.2
• Summary: Plays a role in short-term synaptic plasticity in a subset of GABAergic neurons in the brain.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane