EAF1 (NM_033083) Human Mass Spec Standard

CAT#: PH307169

EAF1 MS Standard C13 and N15-labeled recombinant protein (NP_149074)

Product Images

Coomassie blue staining of purified EAF1 protein (Cat# TP307169). The protein was produced from HEK293T cells transfected with EAF1 cDNA clone (Cat# RC207169) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207169
• Predicted MW: 29 kDa
• Protein Sequence:
  Sequence Link

  >RC207169 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTP
  PMTVFKGNKRPYQKDCVLIINHDTGEFVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPP
  PPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSS
  SGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNALRNDLQLSESGSDSDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_149074
• RefSeq Size: 4503
• RefSeq ORF: 804
• Locus ID: 85403
• UniProt ID: Q96JC9
• Cytogenetics: 3p25.1
• Summary: Acts as a transcriptional transactivator of ELL and ELL2 elongation activities.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transcription Factors