ZCCHC13 (NM_203303) Human Mass Spec Standard

CAT#: PH306078

ZCCHC13 MS Standard C13 and N15-labeled recombinant protein (NP_976048)

Product Images

Coomassie blue staining of purified ZCCHC13 protein (Cat# TP306078). The protein was produced from HEK293T cells transfected with ZCCHC13 cDNA clone (Cat# RC206078) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206078
• Predicted MW: 18 kDa
• Protein Sequence:
  Sequence Link

  >RC206078 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNC
  GRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVA
  INCSKARPGQLLPLRQIPTSSQGMSQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_976048
• RefSeq Size: 859
• RefSeq ORF: 498
• Synonyms: CNBP2; ZNF9L
• Locus ID: 389874
• UniProt ID: Q8WW36
• Cytogenetics: Xq13.2
• Summary: This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 3. However, the CDS of this intronless gene remains relatively intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein. The encoded protein contains six CCHC-type zinc fingers, and is thus thought to function as a transcription factor. [provided by RefSeq, May 2010]