FAAP24 (NM_152266) Human Mass Spec Standard

CAT#: PH305872

C19orf40 MS Standard C13 and N15-labeled recombinant protein (NP_689479)

Product Images

Coomassie blue staining of purified FAAP24 protein (Cat# TP305872). The protein was produced from HEK293T cells transfected with FAAP24 cDNA clone (Cat# RC205872) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205872
• Predicted MW: 23.7 kDa
• Protein Sequence:
  Sequence Link

  >RC205872 representing NM_152266
  Red=Cloning site Green=Tags(s)
  
  MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGN
  GYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEP
  SKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAF
  FTQPR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689479
• RefSeq Size: 1130
• RefSeq ORF: 645
• Synonyms: C19orf40
• Locus ID: 91442
• UniProt ID: Q9BTP7, A0A0S2Z5V6
• Cytogenetics: 19q13.11
• Summary: FAAP24 is a component of the Fanconi anemia (FA) core complex (see MIM 227650), which plays a crucial role in DNA damage response (Ciccia et al., 2007 [PubMed 17289582]).[supplied by OMIM, Mar 2008]