Neurokinin B (TAC3) (NM_013251) Human Mass Spec Standard

CAT#: PH305666

TAC3 MS Standard C13 and N15-labeled recombinant protein (NP_037383)

Product Images

Coomassie blue staining of purified TAC3 protein (Cat# TP305666). The protein was produced from HEK293T cells transfected with TAC3 cDNA clone (Cat# RC205666) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205666
• Predicted MW: 13.4 kDa
• Protein Sequence:
  Sequence Link

  >RC205666 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTD
  PKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037383
• RefSeq Size: 841
• RefSeq ORF: 363
• Synonyms: HH10; LncZBTB39; NK3; NKB; NKNB; PRO1155; ZNEUROK1
• Locus ID: 6866
• UniProt ID: Q9UHF0, A0A024RB47
• Cytogenetics: 12q13.3
• Summary: This gene encodes a member of the tachykinin family of secreted neuropeptides. The encoded preproprotein is proteolytically processed to generate the mature peptide, which is primarily expressed in the central and peripheral nervous systems and functions as a neurotransmitter. This peptide is the ligand for the neurokinin-3 receptor. This protein is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. Mutations in this gene are associated with normosmic hypogonadotropic hypogonadism. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]
• Protein Families: Druggable Genome, Secreted Protein