C2orf65 (M1AP) (NM_138804) Human Mass Spec Standard

CAT#: PH305518

C2orf65 MS Standard C13 and N15-labeled recombinant protein (NP_620159)

Product Images

Coomassie blue staining of purified M1AP protein (Cat# TP305518). The protein was produced from HEK293T cells transfected with M1AP cDNA clone (Cat# RC205518) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205518
• Predicted MW: 59.4 kDa
• Protein Sequence:
  Sequence Link

  >RC205518 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MHPGRTTGKGPSTHTQIDQQPPRLLIVHIALPSWADICTNLCEALQNFFSLACSLMGPSRMSLFSLYMVQ
  DQHECILPFVQVKGNFARLQTCISELRMLQREGCFRSQGASLRLAVEDGLQQFKQYSRHVTTRAALTYTS
  LEITILTSQPGKEVVKQLEEGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDLQ
  TIDNDIVSMEIFFKAWLHNSGTDQEQIHLLLSSQCFSNISRPRDNPMCLKCDLQERLLCPSLLAGTADGS
  LRMDDPKGDFITLYQMASQSSASHYKLQVIKALKSSGLCESLTYGLPFILRPTSCWQLDWDELETNQQHF
  HALCHSLLKREWLLLAKGEPPGPGHSQRIPASTFYVIMPSHSLTLLVKAVATRELMLPSTFPLLPEDPHD
  DSLKNVESMLDSLELEPTYNPLHVQSHLYSHLSSIYAKPQGRLHPHWESRAPRKHPCKTGQLQTNRARAT
  VAPLPMTPVPGRASKMPAASKSSSDAFFLPSEWEKDPSRP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620159
• RefSeq Size: 2558
• RefSeq ORF: 1590
• Synonyms: C2orf65; D6Mm5e; SPATA37; SPGF48
• Locus ID: 130951
• UniProt ID: Q8TC57
• Cytogenetics: 2p13.1
• Summary: This gene encodes a protein that is likely to function in progression of meiosis. A similar protein in mouse plays a role in gametogenesis in both sexes. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]