S100A16 (NM_080388) Human Mass Spec Standard
CAT#: PH303879
S100A16 MS Standard C13 and N15-labeled recombinant protein (NP_525127)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203879 |
Predicted MW | 11.6 kDa |
Protein Sequence |
>RC203879 representing NM_080388
Red=Cloning site Green=Tags(s) MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANH DGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_525127 |
RefSeq Size | 1085 |
RefSeq ORF | 309 |
Synonyms | AAG13; DT1P1A7; S100F |
Locus ID | 140576 |
UniProt ID | Q96FQ6 |
Cytogenetics | 1q21.3 |
Summary | Calcium-binding protein. Binds one calcium ion per monomer (PubMed:17030513). Can promote differentiation of adipocytes (in vitro) (By similarity). Overexpression in preadipocytes increases their proliferation, enhances adipogenesis and reduces insulin-stimulated glucose uptake (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409181 | S100A16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409181 | Transient overexpression lysate of S100 calcium binding protein A16 (S100A16) |
USD 436.00 |
|
TP303879 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A16 (S100A16), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review