S100A16 (NM_080388) Human Mass Spec Standard

CAT#: PH303879

S100A16 MS Standard C13 and N15-labeled recombinant protein (NP_525127)

Product Images

Coomassie blue staining of purified S100A16 protein (Cat# TP303879). The protein was produced from HEK293T cells transfected with S100A16 cDNA clone (Cat# RC203879) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203879
• Predicted MW: 11.6 kDa
• Protein Sequence:
  Sequence Link

  >RC203879 representing NM_080388
  Red=Cloning site Green=Tags(s)
  
  MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANH
  DGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_525127
• RefSeq Size: 1085
• RefSeq ORF: 309
• Synonyms: AAG13; DT1P1A7; S100F
• Locus ID: 140576
• UniProt ID: Q96FQ6
• Cytogenetics: 1q21.3
• Summary: Calcium-binding protein. Binds one calcium ion per monomer (PubMed:17030513). Can promote differentiation of adipocytes (in vitro) (By similarity). Overexpression in preadipocytes increases their proliferation, enhances adipogenesis and reduces insulin-stimulated glucose uptake (By similarity).[UniProtKB/Swiss-Prot Function]