RAB14 (NM_016322) Human Mass Spec Standard
CAT#: PH302832
RAB14 MS Standard C13 and N15-labeled recombinant protein (NP_057406)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202832 |
Predicted MW | 23.9 kDa |
Protein Sequence |
>RC202832 protein sequence
Red=Cloning site Green=Tags(s) MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQ ERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK QFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR EGCGC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057406 |
RefSeq Size | 4379 |
RefSeq ORF | 645 |
Synonyms | FBP; RAB-14 |
Locus ID | 51552 |
UniProt ID | P61106, A0A024R845 |
Cytogenetics | 9q33.2 |
Summary | RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]).[supplied by OMIM, Mar 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414055 | RAB14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414055 | Transient overexpression lysate of RAB14, member RAS oncogene family (RAB14) |
USD 436.00 |
|
TP302832 | Recombinant protein of human RAB14, member RAS oncogene family (RAB14), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review