VAMP4 (NM_003762) Human Mass Spec Standard

CAT#: PH302734

VAMP4 MS Standard C13 and N15-labeled recombinant protein (NP_003753)

Product Images

Coomassie blue staining of purified VAMP4 protein (Cat# TP302734). The protein was produced from HEK293T cells transfected with VAMP4 cDNA clone (Cat# RC202734) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202734
• Predicted MW: 16.2 kDa
• Protein Sequence:
  Sequence Link

  >RC202734 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENI
  TKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003753
• RefSeq Size: 5155
• RefSeq ORF: 363
• Synonyms: VAMP-4; VAMP24
• Locus ID: 8674
• UniProt ID: O75379, Q6IAZ3
• Cytogenetics: 1q24.3
• Summary: Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport