MAD2L1 binding protein (MAD2L1BP) (NM_014628) Human Mass Spec Standard
CAT#: PH302640
MAD2L1BP MS Standard C13 and N15-labeled recombinant protein (NP_055443)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202640 |
Predicted MW | 31.1 kDa |
Protein Sequence |
>RC202640 protein sequence
Red=Cloning site Green=Tags(s) MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCC QFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLED FFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMG TVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055443 |
RefSeq Size | 1283 |
RefSeq ORF | 822 |
Synonyms | CMT2 |
Locus ID | 9587 |
UniProt ID | Q15013 |
Cytogenetics | 6p21.1 |
Summary | The protein encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400374 | MAD2L1BP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC402356 | MAD2L1BP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400374 | Transient overexpression lysate of MAD2L1 binding protein (MAD2L1BP), transcript variant 1 |
USD 436.00 |
|
LY402356 | Transient overexpression lysate of MAD2L1 binding protein (MAD2L1BP), transcript variant 2 |
USD 436.00 |
|
TP302640 | Recombinant protein of human MAD2L1 binding protein (MAD2L1BP), transcript variant 2, 20 µg |
USD 867.00 |
|
TP760973 | Purified recombinant protein of Human MAD2L1 binding protein (MAD2L1BP), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review