ERG28 (C14orf1) (NM_007176) Human Mass Spec Standard

CAT#: PH300238

C14orf1 MS Standard C13 and N15-labeled recombinant protein (NP_009107)

Product Images

Coomassie blue staining of purified ERG28 protein (Cat# TP300238). The protein was produced from HEK293T cells transfected with ERG28 cDNA clone (Cat# RC200238) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200238
• Predicted MW: 15.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200238 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLSSVIRCLCAID
  IHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILGMLVGLRYLEVEPVSRQKKRN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009107
• RefSeq Size: 1576
• RefSeq ORF: 420
• Synonyms: C14orf1; NET51
• Locus ID: 11161
• UniProt ID: Q9UKR5, Q6FII3, Q86TW5
• Cytogenetics: 14q24.3
• Protein Families: Transmembrane