WDR5 (NM_052821) Human Mass Spec Standard
CAT#: PH300162
WDR5 MS Standard C13 and N15-labeled recombinant protein (NP_438172)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200162 |
Predicted MW | 36.6 kDa |
Protein Sequence |
>RC200162 protein sequence
Red=Cloning site Green=Tags(s) MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIK IWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI DDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED NLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_438172 |
RefSeq Size | 3078 |
RefSeq ORF | 1002 |
Synonyms | BIG-3; CFAP89; SWD3 |
Locus ID | 11091 |
UniProt ID | P61964 |
Cytogenetics | 9q34.2 |
Summary | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402599 | WDR5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC409441 | WDR5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402599 | Transient overexpression lysate of WD repeat domain 5 (WDR5), transcript variant 1 |
USD 436.00 |
|
LY409441 | Transient overexpression lysate of WD repeat domain 5 (WDR5), transcript variant 2 |
USD 436.00 |
|
PH316218 | WDR5 MS Standard C13 and N15-labeled recombinant protein (NP_060058) |
USD 3,255.00 |
|
TP300162 | Recombinant protein of human WD repeat domain 5 (WDR5), transcript variant 2, 20 µg |
USD 867.00 |
|
TP316218 | Recombinant protein of human WD repeat domain 5 (WDR5), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review