CMA1 (NM_001836) Human Tagged ORF Clone

CAT#: RC214873

CMA1 (Myc-DDK-tagged)-Human chymase 1, mast cell (CMA1)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_001836" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-CMA1 Antibody
    • 100 ul

USD 539.00

Other products for "CMA1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CMA1
Synonyms chymase; CYH; MCT1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214873 representing NM_001836
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCTTCTTCCTCTCCCCCTGCTGCTCTTTCTCTTGTGCTCCAGAGCTGAAGCTGGGGAGATCATCG
GGGGCACAGAATGCAAGCCACATTCCCGCCCCTACATGGCCTACCTGGAAATTGTAACTTCCAACGGTCC
CTCAAAATTTTGTGGTGGTTTCCTTATAAGACGGAACTTTGTGCTGACGGCTGCTCATTGTGCAGGAAGG
TCTATAACAGTCACCCTTGGAGCCCATAACATAACAGAGGAAGAAGACACATGGCAGAAGCTTGAGGTTA
TAAAGCAATTCCGTCATCCAAAATATAACACTTCTACTCTTCACCACGATATCATGTTACTAAAGTTGAA
GGAGAAAGCCAGCCTGACCCTGGCTGTGGGGACACTCCCCTTCCCATCACAATTCAACTTTGTCCCACCT
GGGAGAATGTGCCGGGTGGCTGGCTGGGGAAGAACAGGTGTGTTGAAGCCGGGCTCAGACACTCTGCAAG
AGGTGAAGCTGAGACTCATGGATCCCCAGGCCTGCAGCCACTTCAGAGACTTTGACCACAATCTTCAGCT
GTGTGTGGGCAATCCCAGGAAGACAAAATCTGCATTTAAGGGAGACTCTGGGGGCCCTCTTCTGTGTGCT
GGGGTGGCCCAGGGCATCGTATCCTATGGACGGTCGGATGCAAAGCCCCCTGCTGTCTTCACCCGAATCT
CCCATTACCGGCCCTGGATCAACCAGATCCTGCAGGCAAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214873 representing NM_001836
Red=Cloning site Green=Tags(s)

MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGR
SITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPP
GRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCA
GVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001836
ORF Size 741 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001836.2
RefSeq Size 744 bp
RefSeq ORF 744 bp
Locus ID 1215
UniProt ID P23946
Cytogenetics 14q12
Protein Families Druggable Genome, Protease, Secreted Protein
Protein Pathways Renin-angiotensin system
MW 27.1 kDa
Gene Summary This gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Alternative splicing results in multiple variants. [provided by RefSeq, Apr 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.